PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_178.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HD-ZIP
Protein Properties Length: 544aa    MW: 61807.7 Da    PI: 7.3573
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_178.20genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.94.7e-203082456
                                  -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                                   +++t++q+e Le++F+ +++p++++r++L+++lgL+ +qVk+WFqN+R++ k
  evm.model.supercontig_178.20 30 YHRHTSSQIEHLESFFKDCPHPDESQRRQLSTELGLEPKQVKFWFQNKRTQTK 82
                                  6789*********************************************9987 PP

2START125.37.4e-402474673206
                                   HHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG CS
                         START   3 aeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke 70 
                                   a +a++elv++  ++ep+W +s             +d++ ++f++ +      +++e +++sg+ +m  a lv+ ++d   
  evm.model.supercontig_178.20 247 AASAMDELVRLLRVNEPLWIRSElsgsraviH---RDTYDKIFPRINRfknsnSRIESSKESGMITMSGAHLVKMIMDPE- 323
                                   6789*******************998874444...4444444444322566888***********************999. PP

                                   CT-TT-S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-T CS
                         START  71 qWdetla....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppess 140
                                   +W+  ++    k e l  ++ g      g l lm+ ++  lsplvp R+f ++R++rql++g wv vdvS d + + p   
  evm.model.supercontig_178.20 324 KWTDLFPtivcKTEQLYEVQAGtsgnknGCLLLMYEKMHILSPLVPaREFIILRHCRQLEKGLWVMVDVSYDLKGHIPP-- 402
                                   *******998855555566666777899***********************************************9997.. PP

                                   TSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 141 svvRaellpSgiliepksnghskvtwvehvdlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                                      R+ +lpSg++i++++ng skv+w+ehv++++++  h l+r l+ sg a ga +w  tlqr ce+
  evm.model.supercontig_178.20 403 --SRCWKLPSGCMIQEMANGCSKVIWIEHVEVDDKTLtHRLYRDLLCSGSAYGAERWIVTLQRICER 467
                                   ..8*******************************9988***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.09E-181184IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-201286IPR009057Homeodomain-like
PROSITE profilePS5007116.4872484IPR001356Homeobox domain
SMARTSM003892.0E-162688IPR001356Homeobox domain
CDDcd000862.65E-162785No hitNo description
PfamPF000461.5E-173082IPR001356Homeobox domain
PROSITE patternPS0002705982IPR017970Homeobox, conserved site
PROSITE profilePS5084841.241236470IPR002913START domain
SuperFamilySSF559611.92E-29238468No hitNo description
CDDcd088751.29E-97240466No hitNo description
SMARTSM002341.2E-28245467IPR002913START domain
PfamPF018522.8E-33247467IPR002913START domain
Gene3DG3DSA:3.30.530.208.9E-6299431IPR023393START-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MDLGMGNDGT NNSSDEQGTS NRSGSEKKIY HRHTSSQIEH LESFFKDCPH PDESQRRQLS  60
TELGLEPKQV KFWFQNKRTQ TKAQSERADN SVLRAENERI QCENLAIREA LKNVMCPACG  120
GPPFGEEERQ RSLQKLQMEN ALLKEEHEKV SNLLAKYLGK PISQFEAMST STRGEGPSNA  180
LDFLPPSYLT QGLVGFPFLD NLDNFSQKYR ENINNNLPAN NHVIDLQQHF DARLISDVEK  240
AFMVETAASA MDELVRLLRV NEPLWIRSEL SGSRAVIHRD TYDKIFPRIN RFKNSNSRIE  300
SSKESGMITM SGAHLVKMIM DPEKWTDLFP TIVCKTEQLY EVQAGTSGNK NGCLLLMYEK  360
MHILSPLVPA REFIILRHCR QLEKGLWVMV DVSYDLKGHI PPSRCWKLPS GCMIQEMANG  420
CSKVIWIEHV EVDDKTLTHR LYRDLLCSGS AYGAERWIVT LQRICERLAF SMADNPHVYH  480
HNSVMPNSMK SMLKLCHRMV KDFCAGLCMS CDNKLDFPQI SEVNSSGVRV CVREGMGRAN  540
LVA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002526595.20.0PREDICTED: homeobox-leucine zipper protein ROC8 isoform X2
TrEMBLV4S6730.0V4S673_9R
STRINGPOPTR_0004s07310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2405323
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.11e-155homeodomain GLABROUS 11